PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G02494.1.p
Common NameEUGRSUZ_G02494, LOC104453942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 354aa    MW: 39241 Da    PI: 7.0492
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G02494.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.5e-321872155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprl+WtpeLH+rFveav qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  Eucgr.G02494.1.p 18 KPRLKWTPELHHRFVEAVMQLGGADKATPKSLMRAMGIPGLTLYHLKSHLQKYRL 72
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.3951575IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-301674IPR009057Homeodomain-like
SuperFamilySSF466896.63E-161773IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-221873IPR006447Myb domain, plants
PfamPF002492.2E-82071IPR001005SANT/Myb domain
PfamPF143791.3E-22122168IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGLQNHQKMN LVLSTDAKPR LKWTPELHHR FVEAVMQLGG ADKATPKSLM RAMGIPGLTL  60
YHLKSHLQKY RLGKSQQSES CIDTKQEGEF YATENKEVQS ADEYQNTEII DPSTFQMNES  120
LQIAQALQMQ MEVQRKLHEQ IEVQKHLQLR IEAQGKYLQS VLRKAQETLA RYNNSPVGID  180
AAKAELSQLV SMVSSGCPGS PFSELTELGS SDLNDAARKQ LKGICSVESS LTSSESSGRN  240
EEKPKGNEHG EMHNFSPTSI ELRLSNIRPE EVPSQNICNK TTGRKRCASS GSDDNSLIAE  300
QSSKSSPRTS YKQKKCGLPV TLDLNSQYQA DFDPGPKSID LNFQGIEQAN GHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G02494.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066903.10.0PREDICTED: myb family transcription factor APL
TrEMBLA0A059BFT60.0A0A059BFT6_EUCGR; Uncharacterized protein
STRINGVIT_01s0026g02550.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.19e-83G2-like family protein